Agriculture and Consumer Protection - PDFSEARCH.IO - Document Search Engine

Agriculture and Consumer Protection
Results: 591

#	Item
431	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Scientific Steering Committee OPINION ON Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:34:01 Agriculture Transmissible spongiform encephalopathies Animal welfare Proteins Animal rights Scrapie Stunning Pithing Gelatin Meat industry Biology Food and drink
432	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate B - Scientific Health Opinions Unit C1 - Monitoring and dissemination of scientific opinions Scientific Steering Committee Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:33:31 Molecular biology Herbicides Genetic engineering Amines Glyphosate Cotton Tampon Genetically modified organism Genetically modified plant Biology Chemistry Agriculture
433	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate F - Food and Veterinary Office DG(SANCO[removed]MR Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:49:58 Dacinae Agriculture Biology Citrus canker Sterile insect technique Land management Anastrepha ludens Melon fly Citrus Bactrocera Agricultural pest insects Trypetinae
434	Farm Credit Administration Strategic Plan May 2013 Fiscal Years 2013−2018 Add to Reading List Source URL: www.fca.gov Language: English - Date: 2013-09-10 11:42:24 Farm Credit Administration Government-sponsored enterprise Farm Credit Act Fannie Mae Freddie Mac Federal Agricultural Mortgage Corporation Dodd–Frank Wall Street Reform and Consumer Protection Act United States Department of Agriculture Food security Mortgage industry of the United States Economy of the United States Farm Credit System
435	H.R.4217 Federal Crop Insurance Reform and Department of Agriculture Reorganization Act of[removed]Enrolled Bill (Sent to President)) Add to Reading List Source URL: www.usda.gov Language: English - Date: 2014-09-25 09:30:17 Ethics Actuarial science Emergency management Occupational safety and health Regulation Cost–benefit analysis Dodd–Frank Wall Street Reform and Consumer Protection Act Investor Protection and Securities Reform Act Management Risk management Risk
436	Farm Credit Administration Fiscal Year 2015 Proposed Budget and Performance Plan Add to Reading List Source URL: www.fca.gov Language: English - Date: 2014-03-04 18:21:46 Government-sponsored enterprise Dodd–Frank Wall Street Reform and Consumer Protection Act Federal Farm Credit Banks Funding Corporation Economy of the United States Agriculture Law Farm Credit System Farm Credit Act Farm Credit Administration
437	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate C - Scientific Opinions &0DQDJHPHQWRIVFLHQWLILFFRPPLWWHHVVFLHQWLILFFRRSHUDWLRQDQGQHWZRUNV 2SLQLRQRIWKH6FLHQWLILF&RPPLWWHH Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:33:10 Safety Livestock Food and Drug Administration Food safety Hazard analysis and critical control points Process management Slaughterhouse Animal welfare Food Agriculture Food and drink Meat industry
438	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate F - Food and Veterinary Office Unit 4 - Food of plant origin, plant health; processing and distribution In cooperation with JRC Ispra, IHCP Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:48:27 Chemistry Agriculture Pesticide residue Maximum Residue Limit Pesticide Glyphosate Organic food Chlorpyrifos Pesticides Soil contamination Environment
439	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate F - Food and Veterinary Office Unit 4 - Food of plant origin, plant health; processing and distribution In cooperation with JRC Ispra, IHCP Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:48:33 Agriculture Earth Pesticide residue Maximum Residue Limit Pesticide Health effects of pesticides Pesticides Soil contamination Environment
440	EUROPEAN COMMISSION HEALTH & CONSUMER PROTECTION DIRECTORATE-GENERAL Directorate C - Scientific Opinions C3 - Management of scientific committees II; scientific co-operation and networks SCIENTIFIC COMMITTEE ON PLANTS Add to Reading List Source URL: ec.europa.eu Language: English - Date: 2012-03-20 14:32:37 Genetic engineering Plant reproduction Energy crops Fodder Environmental issues Genetically modified organism Genetically modified food Brassica napus Pollen barrier Biology Food and drink Agriculture

UPDATE